PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100249220142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 262aa    MW: 29646.7 Da    PI: 8.784
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100249220142genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.61.4e-281165155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  k+rl+Wt+eLH+ F +av+q+GG+++AtPk il++m ++gLt+ hvkSHLQkYR+
  Ote100249220142|100249220142 11 KERLKWTKELHDLFEKAVNQIGGPDRATPKGILKAMAIPGLTIFHVKSHLQKYRM 65
                                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-17865IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-27966IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-221165IPR006447Myb domain, plants
PfamPF002497.7E-81364IPR001005SANT/Myb domain
PfamPF143794.5E-1898142IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGSNRANCSS KERLKWTKEL HDLFEKAVNQ IGGPDRATPK GILKAMAIPG LTIFHVKSHL  60
QKYRMSVFTR EEDHTKGKLE RRSVSEMLPN FSALSGAQLN EALLIQMEAQ RRLSDQLEVQ  120
KSLKMKIEAQ GRFLDKIMEE YKNRSPGTKQ IKPYSPVLSL PSLSEESDQS NGKEFESDSS  180
EVGEISSKEE FRAQKRIKIQ EQNVMPQINR APSFNLDSQS LNLFCLDGIS KNLYSDQEMG  240
CPWGGNAFSS PLLLGMYNQL NQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077547.11e-149PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077548.11e-149PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077549.11e-149PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077550.11e-149PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A022QJI31e-138A0A022QJI3_ERYGU; Uncharacterized protein
STRINGPOPTR_0016s12430.18e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026